PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 496330
Common NameARALYDRAFT_496330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 322aa    MW: 35334.1 Da    PI: 9.7145
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
496330genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-13108153247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+  ++ + ++lG+g+W+ Ia+ + ++Rt+ q+ s+ qky
           496330 108 KPWTEEEHRNFLIGLNKLGKGDWRGIAKSFVTTRTPTQVASHAQKY 153
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6141225IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.47102158IPR017930Myb domain
SuperFamilySSF466897.48E-17104158IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-16105156IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-11106152IPR009057Homeodomain-like
SMARTSM007174.2E-10106156IPR001005SANT/Myb domain
PfamPF002492.3E-11108153IPR001005SANT/Myb domain
CDDcd001677.77E-9109154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVKETVMVAK TCSHCGHNGH NARTCLNGVN KGSVKLFGVN ISSDPIRPPE VTALRKSLSL  60
GNLDALLAND DSNGNGDPIA AVDDTGYHSD GQIHSKKGKT AHEKKKGKPW TEEEHRNFLI  120
GLNKLGKGDW RGIAKSFVTT RTPTQVASHA QKYFIRLNVN DKRKRRASLF DISLEDQKEK  180
EMNSQDASTS SSKTPPKQPI TGIQQPVVQG QTHTEISNRF QSLSMEYMPI YQTVPPYYNF  240
PPLMFHPMYY STPEVPVRFV HPSGIPVPRH IPIGMPQSQS NEASNMTKKD GLDLDIGLPP  300
PLPQATTGAT DLTGHGVIHV K*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0122391e-152AB012239.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K11J9.
GenBankCP0026881e-152CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864744.10.0myb family transcription factor
TrEMBLD7MV430.0D7MV43_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.8__2146__AT5G61620.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-174MYB_related family protein